PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.074600.1
Common NameCsa_3G100800, LOC101204885
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NAC
Protein Properties Length: 338aa    MW: 37592.8 Da    PI: 8.5823
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.074600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.81e-53151431128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkk+++++l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+r++ky++g r+nra++sgyWkatg+dk+vl++
  Cucsa.074600.1  15 LPPGFRFHPTDEELVVHYLKKKANSSPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRERKYPNGARPNRAATSGYWKATGTDKPVLAS 108
                     79****************************.88***************988899***************************************99 PP

             NAM  96 ..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++vg+kk Lvfy g+ pkg kt+W+mheyrl
  Cucsa.074600.1 109 dgSNQKVGVKKALVFYGGKPPKGIKTNWIMHEYRL 143
                     777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-647178IPR003441NAC domain
PROSITE profilePS5100561.40315178IPR003441NAC domain
PfamPF023654.7E-2816143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MESTDSSAGP QQPNLPPGFR FHPTDEELVV HYLKKKANSS PLPVAIIAEV DLYKFDPWEL  60
PAKATFGEQE WYFFSPRERK YPNGARPNRA ATSGYWKATG TDKPVLASDG SNQKVGVKKA  120
LVFYGGKPPK GIKTNWIMHE YRLADNKPCI NKPPGYDLAN KKNSLKLDDW VLCRIYKKNN  180
SHRPMDQERE DSMEEMIGSI PHSLRLNDQY PKLGINYSTL LENDQNLLQG IVANNNNDNN  240
NNGAVSNDQD HSGISSNKRL HFENTTDGAS TSITRTHSSS HNNLQNSTSS FTTLLTNLPQ  300
TPPPPLHHHS GAHSVLASIG DGLFRPAYQI PGANWYS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D1e-731218117171NAC domain-containing protein 19
3swp_C1e-731218117171NAC domain-containing protein 19
3swp_B1e-731218117171NAC domain-containing protein 19
3swp_A1e-731218117171NAC domain-containing protein 19
3swm_D1e-731218117171NAC domain-containing protein 19
3swm_C1e-731218117171NAC domain-containing protein 19
3swm_B1e-731218117171NAC domain-containing protein 19
3swm_A1e-731218117171NAC domain-containing protein 19
4dul_B1e-731218114168NAC domain-containing protein 19
4dul_A1e-731218114168NAC domain-containing protein 19
1ut7_B1e-731218114168NO APICAL MERISTEM PROTEIN
1ut7_A1e-731218114168NO APICAL MERISTEM PROTEIN
1ut4_B1e-731218114168NO APICAL MERISTEM PROTEIN
1ut4_A1e-731218114168NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818581e-161LN681858.1 Cucumis melo genomic scaffold, anchoredscaffold00028.
GenBankLN7132601e-161LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004149287.10.0PREDICTED: NAC transcription factor 25
SwissprotQ9LD441e-112NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A0A0L2L30.0A0A0A0L2L3_CUCSA; Uncharacterized protein
STRINGGLYMA12G34990.11e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-107NAC domain containing protein 2
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]